PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000703244
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 84aa    MW: 9608.37 Da    PI: 7.3555
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000703244genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM492e-151966249
            NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
                    +GfrF+Pt+eel++ yL  k+egk+  +++vi+e++i+++eP+dLp 
  MDP0000703244 19 XVGFRFRPTEEELIDXYLLMKLEGKDYLVSDVIREINICNHEPRDLPG 66
                   68************************9999****************93 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-15968IPR003441NAC domain
PROSITE profilePS5100516.2841883IPR003441NAC domain
PfamPF023658.9E-62059IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MAANRNRFTR AAAGDLSMXV GFRFRPTEEE LIDXYLLMKL EGKDYLVSDV IREINICNHE  60
PRDLPGNYFP KXGLKFSLVF LVQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008360406.18e-33PREDICTED: NAC domain-containing protein 5-like isoform X1
TrEMBLM5XNS92e-14M5XNS9_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114331739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.16e-14NAC 014